DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and dhhc-12

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_492753.2 Gene:dhhc-12 / 186602 WormBaseID:WBGene00010323 Length:310 Species:Caenorhabditis elegans


Alignment Length:268 Identity:64/268 - (23%)
Similarity:111/268 - (41%) Gaps:59/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVFV--LCSTAFFFSLQMFYIAPKVFGDIAYKLY-WILVTFITHNILGNMLACYMTSSSVNTLSK 89
            ::||  ||:..:....:|..:......::::.:: ::|:.:|.::::.:.......:..||.   
 Worm    44 LIFVGTLCNVTYVVIFKMIPVEWNECQNMSFFVFRFVLLIYIYYSVVFHYYKARTLTPVVNP--- 105

  Fly    90 DSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFY 154
                ..|.|.    :|..|...:.|.:.||..|:.||.|.||||...|.|:|.:||..||.|.||
 Worm   106 ----GTPSDS----FCIKCNNWKGPSTSHCKACDKCIYRMDHHCPHIGQCVGAHNQSHFFLFLFY 162

  Fly   155 LTL--GLVTSFA-TFCMFILQNGGNFMSLSS------VIFN----LITRTFFQNYTGNTFETIAF 206
            |.:  ||....| ||.|..::......::..      ..||    ||||:   ..|.:|....||
 Worm   163 LQIATGLFFLMATTFWMKWIETRKELTAIPDDQCWPPYCFNRYYYLITRS---QGTEDTMVKFAF 224

  Fly   207 LLNISASYMP-----------AFMLAYQMQILSQNS-------TYYNIFDCTYDLGFRK--NCQT 251
            .|.::..::.           :|.|...|::..::.       |::     |....:||  ||| 
 Worm   225 FLFVTLHWIMWGFVGVYVGIISFGLTMAMKMFQKSDAESRKPFTWF-----TIKARWRKYMNCQ- 283

  Fly   252 IMGQRGLW 259
               ...||
 Worm   284 ---DEPLW 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 45/161 (28%)
dhhc-12NP_492753.2 zf-DHHC 39..>172 CDD:303066 37/138 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.