powered by:
Protein Alignment CG17195 and dhhc-2
DIOPT Version :9
Sequence 1: | NP_651427.2 |
Gene: | CG17195 / 43113 |
FlyBaseID: | FBgn0039369 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493007.2 |
Gene: | dhhc-2 / 173062 |
WormBaseID: | WBGene00012948 |
Length: | 404 |
Species: | Caenorhabditis elegans |
Alignment Length: | 62 |
Identity: | 26/62 - (41%) |
Similarity: | 39/62 - (62%) |
Gaps: | 0/62 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 YCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFAT 165
||.:|:..|.||..||.:|:.|:|..||||.:.|.|||..|..:|:.|.|.|::.::..||:
Worm 201 YCTTCRLYRPPRCSHCAICDNCVLMFDHHCPWVGNCIGLRNYTYFYRFVFCLSILVIYLFAS 262
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.