DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and Zdhhc7

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_596885.1 Gene:Zdhhc7 / 170906 RGDID:620205 Length:308 Species:Rattus norvegicus


Alignment Length:195 Identity:47/195 - (24%)
Similarity:73/195 - (37%) Gaps:64/195 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GDIAYKLYWILVTF-------------------ITHNILGNMLACYMTSSSVNTLSKDSRCPN-- 95
            |.:...:.|:||.:                   :.:.:|.|.||....||.:.|:..|   |.  
  Rat    47 GMVCAVMTWLLVVYADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTD---PGAV 108

  Fly    96 PEDEPLWHYCES-----------CKK---LRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQR 146
            |:......|.||           |.|   ::..|:.||.:|..||.:.||||.:...|:|..|||
  Rat   109 PKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQR 173

  Fly   147 FFFWFTFYLTLGLVTSFA--------------TFC------------MFILQNGGNFMSLSSVIF 185
            ||..||.|:.|..:.:..              |.|            :|:...|..|.:.::|:|
  Rat   174 FFVLFTMYIALSSIHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMF 238

  Fly   186  185
              Rat   239  238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 33/123 (27%)
Zdhhc7NP_596885.1 DHHC 131..258 CDD:396215 30/108 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.