Sequence 1: | NP_651427.2 | Gene: | CG17195 / 43113 | FlyBaseID: | FBgn0039369 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_659406.1 | Gene: | ZDHHC15 / 158866 | HGNCID: | 20342 | Length: | 337 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 50/197 - (25%) |
---|---|---|---|
Similarity: | 88/197 - (44%) | Gaps: | 48/197 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 YCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCM 168
Fly 169 FILQNGGNFMSLSSVIFNLITRTFFQNYTGNTFET------IAFLLNISASYMPAFML--AYQMQ 225
Fly 226 ILSQNSTYYNIFDCT-----------YDLGFRKNCQTIMG-QRGLWTFISPLLKSPLPHDGAHWQ 278
Fly 279 MK 280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17195 | NP_651427.2 | zf-DHHC | 103..234 | CDD:279823 | 33/137 (24%) |
ZDHHC15 | NP_659406.1 | zf-DHHC | <126..308 | CDD:327686 | 50/197 (25%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 306..337 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |