DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and ZDHHC19

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001034706.1 Gene:ZDHHC19 / 131540 HGNCID:20713 Length:309 Species:Homo sapiens


Alignment Length:326 Identity:75/326 - (23%)
Similarity:121/326 - (37%) Gaps:108/326 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VRIVHPL----------------SIVFVLCSTAFFFSLQMFYIA-------PKVFGDIAYKLYWI 61
            |:..|||                ::|.::..:..||:....::|       |.:.|.:....::.
Human    11 VKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWAFPVITGSLFVLTFFS 75

  Fly    62 LVTFITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEPL-----W--------HYCESCKKLRS 113
            ||:              :..|....|.:.|    .|..||     |        .:|..|...|.
Human    76 LVS--------------LNFSDPGILHQGS----AEQGPLTVHVVWVNHGAFRLQWCPKCCFHRP 122

  Fly   114 PRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFM 178
            ||::||..||.|:...||||.:...||||.|.|||    ..|.|.|       |::     ...|
Human   123 PRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRFF----MLLVLSL-------CLY-----SGAM 171

  Fly   179 SLSSVIFNLITRTFFQNYTGNTFETIAFLLNISAS----YMPAFMLAYQMQILSQNSTY------ 233
            .::.:||  :.||....:  :|.:.||.::.:||:    .:...:|...:.:.|.:.||      
Human   172 LVTCLIF--LVRTTHLPF--STDKAIAIVVAVSAAGLLVPLSLLLLIQALSVSSADRTYKGKCRH 232

  Fly   234 ---YNIFD--CTYD--------LGFRKNCQTIMGQRGL---WTFISPL--------LKSPLPHDG 274
               ||.||  |..:        ||.:...:.:..||.:   ||.:..|        |..|.|..|
Human   233 LQGYNPFDQGCASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNLHPPMSPSALNPPAPTSG 297

  Fly   275 A 275
            :
Human   298 S 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 40/143 (28%)
ZDHHC19NP_001034706.1 DHHC 109..>181 CDD:366691 29/89 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..309 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.