DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and zdhhc13

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_002942880.3 Gene:zdhhc13 / 100493145 XenbaseID:XB-GENE-997024 Length:612 Species:Xenopus tropicalis


Alignment Length:242 Identity:57/242 - (23%)
Similarity:97/242 - (40%) Gaps:70/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SIVFVLCSTAFFFSLQMF-YIAPKVFGDIAYKL----------YWILVTFITHNILGNMLACYMT 80
            :|:|..|  .|:..|..| |..|.: ..:|::|          |:...|:.|.       ..|:.
 Frog   339 AIIFSCC--IFWMFLTWFIYFLPGL-ARVAFQLPFIISMLLLFYFFYKTWCTD-------PGYIK 393

  Fly    81 SS------SVNTLSK----DSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIF 135
            ||      ::.||::    |:|.          :|.||...:..||.||..||:|:.|.|.||::
 Frog   394 SSEEESRQTIITLAEAGCLDARL----------FCTSCLVKKPLRSMHCHACNSCVARFDQHCVW 448

  Fly   136 TGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFFQNYTG-- 198
            ||.|||..||.||  ..|..:|.:|              ||:|..:       |..::.::.|  
 Frog   449 TGQCIGAGNQHFF--VLFLASLAVV--------------GNWMIYA-------TSVYWSDHCGMG 490

  Fly   199 ----NTFETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTY 241
                ..:.|::.::|.|...:..|.|.....:.:.......:|..::
 Frog   491 SRKDGIWATLSQIVNCSPWVLYIFCLVSAFTVWATLMLLVQLFQISF 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 36/136 (26%)
zdhhc13XP_002942880.3 Ank_2 46..136 CDD:372319
ANK repeat 71..102 CDD:293786
PHA03095 82..>246 CDD:222980
ANK repeat 104..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK repeat 171..237 CDD:293786
DHHC 327..>549 CDD:388695 57/242 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.