DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and zdhhc23a

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_021327278.1 Gene:zdhhc23a / 100150190 ZFINID:ZDB-GENE-060526-38 Length:434 Species:Danio rerio


Alignment Length:281 Identity:65/281 - (23%)
Similarity:103/281 - (36%) Gaps:99/281 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TAFFFSLQMFYIAPKVFGDIAYKLYWILVTFI------TH-----NILGNML------------- 75
            |.||.||.:|        .:|| :|::.:|.|      ||     ...|.||             
Zfish   126 TLFFLSLALF--------SLAY-MYYLFLTEIVPRGDVTHLQVVTATTGMMLTLISLVRTKQGPG 181

  Fly    76 ------------ACYMTSSSVN-TLSKDSRCPN-----PEDEPLWHYCESCKKLRSPRSWHCVLC 122
                        :...|:.|.| ||..|.|  |     ..::.:...|..|:.:|.||:.||.:|
Zfish   182 FVKSQSLALGINSSLATNRSTNLTLDTDLR--NGVSHLKGEKDVKKKCPVCQLVRPPRAGHCRIC 244

  Fly   123 NTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSF-------------------ATFCM 168
            ..|:||.||||::..:|:|..|.|   .|...|.|.|:|||                   ..:|.
Zfish   245 GACVLRMDHHCVWINSCVGQANHR---QFILTLLLFLLTSFYGISLVLRSICPKQSLFTAMLYCP 306

  Fly   169 FILQNGGNFMSLSSVIFNLITRTFFQNYTGNTFET-IAFLLNISASYMPAFMLAYQMQILSQNST 232
            .:.......:..:.|.:::|       .||..... |..::|:|.:     :...:.||..:|.|
Zfish   307 GVYNQYSTALCFTCVWYSVI-------ITGGLLHLFILQIINVSCN-----VTEREAQIALRNKT 359

  Fly   233 YYNIFDCTYDLGFRKNCQTIM 253
                       |.|:.|..::
Zfish   360 -----------GRRRFCGLVV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 38/150 (25%)
zdhhc23aXP_021327278.1 zf-DHHC 224..352 CDD:307600 34/142 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.