DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17195 and zdhhc9

DIOPT Version :9

Sequence 1:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001096162.1 Gene:zdhhc9 / 100124706 XenbaseID:XB-GENE-1016830 Length:365 Species:Xenopus tropicalis


Alignment Length:262 Identity:58/262 - (22%)
Similarity:99/262 - (37%) Gaps:71/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSIVFVLCSTAFFFSLQMFYIAP------KVFGDIAYKLYW---ILVTFITHNILGNML---ACY 78
            |:::.:|.:.:.||:.:..|:|.      .||..:.:....   :..:|....::...|   |.:
 Frog    40 LTLILILGTCSLFFAFECRYLAVHLSPAIPVFAAVLFLFAMATLLRTSFSDPGVIPRALPDEAAF 104

  Fly    79 --MTSSSVNTLSKDSRCPNPEDEPL--------WHYCESCKKLRSPRSWHCVLCNTCILRRDHHC 133
              |...:.|......:.|.|..:.:        ..||.:||..|.||:.||.:|:.|:.|.||||
 Frog   105 IEMEIEAANGNVPQGQRPPPRIKNVQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHC 169

  Fly   134 IFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFFQNYTG 198
            .:.|.|:|..|.|:|:.|...|:|..:..||                    ||::       |..
 Frog   170 PWVGNCVGKRNYRYFYLFILSLSLLTIYIFA--------------------FNIV-------YVA 207

  Fly   199 NTFETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKNCQTIMGQRGLWTFIS 263
            ....:|.||..:..|                ..|...:|.|.:.|      .:::|..|..||:.
 Frog   208 LNSLSIGFLNTLKES----------------PGTVLEVFICFFTL------WSVVGLTGFHTFLV 250

  Fly   264 PL 265
            .|
 Frog   251 SL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 35/130 (27%)
zdhhc9NP_001096162.1 DHHC 138..261 CDD:366691 43/164 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.