DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and PFA3

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_014073.1 Gene:PFA3 / 855390 SGDID:S000005270 Length:336 Species:Saccharomyces cerevisiae


Alignment Length:261 Identity:55/261 - (21%)
Similarity:89/261 - (34%) Gaps:67/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AIFTTYNILGN-----------LLACYRTSSAVKSLPQERQIPKPGT---EHLWHYCDICQKLMP 113
            |::|.|.::..           |:...:.:.....||.|....:..|   :..:..|.:|....|
Yeast    50 ALYTYYKVIARGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCLTLKHDGRFRVCQVCHVWKP 114

  Fly   114 PRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVG------- 171
            .|..||:.|..||||.||||.:.|.|.|..|.::|.....|.....|:.:.....::|       
Yeast   115 DRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTLYAFLVLIYTCYELGTWFNSGS 179

  Fly   172 --RSFYLLHRMKAGFGNTVKSLSYFRYVCLIL--------NIFALGFPALMLRFQVQILKLNSTY 226
              |.....|.:..........:|...:.|..:        .|...|    |.|::..:..||.:|
Yeast   180 FNRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQTTIEVHG----MRRYRRDLEILNDSY 240

  Fly   227 YQISSRHH-----DLG-FRNNCQLIMG-----------------------QRGLWTFISPSLRSP 262
               .:..|     ||| ...|.|.|||                       ::||:..:.|.::..
Yeast   241 ---GTNEHLENIFDLGSSMANWQDIMGTSWLEWILPIETFKYKKSKHTKDEKGLYFNVRPQVQDR 302

  Fly   263 L 263
            |
Yeast   303 L 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 34/141 (24%)
PFA3NP_014073.1 COG5273 1..304 CDD:227598 55/261 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.