DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and ZDHHC18

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_115659.1 Gene:ZDHHC18 / 84243 HGNCID:20712 Length:388 Species:Homo sapiens


Alignment Length:265 Identity:62/265 - (23%)
Similarity:103/265 - (38%) Gaps:77/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GH----PLSVIFLLVSTVFFFTLQVFYVA-------PDVHDGFMYKFFVISAI----FTTYNILG 72
            ||    .|:::.:|.:|..||.....|:|       |.:  ..:..|||:|.:    ||...||.
Human    89 GHGGVFALTLLLILTTTGLFFVFDCPYLARKLTLAIPII--AAILFFFVMSCLLQTSFTDPGILP 151

  Fly    73 NLLACYRT----------SSAVKSLPQERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCIL 127
            ....|...          ||..:..|:.|::...|......||..|:...|||:.||::|..|:.
Human   152 RATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLKYCFTCKMFRPPRTSHCSVCDNCVE 216

  Fly   128 KRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLS 192
            :.||||.:...|:|..|:|:|:      ||.:.:|..|.|:                        
Human   217 RFDHHCPWVGNCVGRRNYRFFY------AFILSLSFLTAFI------------------------ 251

  Fly   193 YFRYVCLI--LNIFALG--FPALMLRFQVQILKLNSTYYQISSRHHDLGFRNNCQLIMGQRGLWT 253
               :.|::  |.:.|.|  |.:.:......:|:|...::.|.|             |:|..|..|
Human   252 ---FACVVTHLTLRAQGSNFLSTLKETPASVLELVICFFSIWS-------------ILGLSGFHT 300

  Fly   254 FISPS 258
            ::..|
Human   301 YLVAS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 31/128 (24%)
ZDHHC18NP_115659.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
zf-DHHC 191..314 CDD:279823 38/161 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.