DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and AT3G56920

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_191251.2 Gene:AT3G56920 / 824859 AraportID:AT3G56920 Length:338 Species:Arabidopsis thaliana


Alignment Length:264 Identity:55/264 - (20%)
Similarity:99/264 - (37%) Gaps:101/264 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLVSTVFF------FTLQVFYVAPDVHDGFMYKFFVISAIFTTYNILGNLLACYRTSSAVKS-LP 88
            ||::|...      |::::.|:....|. |.:...:|.||..|:.....|   :.|||.... :|
plant    36 LLLTTCMIGGPAIAFSIRMAYLISHRHP-FFHSLTLIGAILLTFMAFTFL---FLTSSRDPGIIP 96

  Fly    89 QERQIPK-----------------------PGTEHLW--------HYCDICQKLMPPRSWHCALC 122
            :.:|:.:                       |.|:.:.        .:||.||...|||::||::|
plant    97 RNKQVSEAEIPDVTTQSTEWVTSKLGSVKLPRTKDVMVNGFTVKVKFCDTCQLYRPPRAFHCSIC 161

  Fly   123 KCCILKRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNT 187
            ..|:.:.||||.:...||...|:.:|.         .|:|.:||                     
plant   162 NNCVQRFDHHCPWVGQCIALRNYPFFV---------CFLSCSTL--------------------- 196

  Fly   188 VKSLSYFRYVCLILNIFALGFPALMLRFQVQILKLNSTYYQISSRHHDLGFRNNCQLIMGQRGLW 252
                     :|:.:.:|:          .|.:||::..:|.:.:.          .||:|..||:
plant   197 ---------LCIYVFVFS----------WVSMLKVHGEFYVVLAD----------DLILGVLGLY 232

  Fly   253 TFIS 256
            .|:|
plant   233 CFVS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 28/124 (23%)
AT3G56920NP_191251.2 zf-DHHC 142..263 CDD:279823 36/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.