DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and AT3G04970

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_187148.2 Gene:AT3G04970 / 819657 AraportID:AT3G04970 Length:397 Species:Arabidopsis thaliana


Alignment Length:228 Identity:58/228 - (25%)
Similarity:92/228 - (40%) Gaps:37/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSVIFLLV--STVFFFTLQVFYVAPDVHDGFMYKFFVISAIFTTYNILGNLLACYRTSSAVKSLP 88
            |.||::.:  ||.|......|...|..:.|.::|:....|:..  .::..||.|:.....|.:..
plant    80 LQVIYIAIMGSTYFLTAKSSFIYIPGYYLGDVHKYTSFLAVIV--GVILFLLTCFSDPGTVNAEN 142

  Fly    89 QERQI---PKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYF-- 148
            ..|.|   |.....:....|..|:...|.||.||::|..|:.:.||||.:...|||..|.:||  
plant   143 VSRYISAYPYDDIIYSKKECSTCKIPKPARSKHCSICNRCVARFDHHCGWMNNCIGERNTKYFMA 207

  Fly   149 -----FWLTFY--LAFGIFMS----------MATLFVDVGRSFYLLH----RMKAGFGNTVKSLS 192
                 |.|..|  :|.|..::          :.|::..|.:||..|.    :...|..||...|.
plant   208 FLLWHFLLCLYGTVAIGFILAGRVKELRVVHILTVYYGVDKSFRSLAPRVIQWLVGTYNTQILLM 272

  Fly   193 YFRYVCLILNIFALGFPALMLRFQVQILKLNST 225
            .|   ..|:::...||.|    :...:...|:|
plant   273 VF---LAIVSLLLAGFFA----YHANLCLTNTT 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 40/146 (27%)
AT3G04970NP_187148.2 DHHC 90..>218 CDD:388695 36/129 (28%)
DHHC 155..305 CDD:366691 40/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.