Sequence 1: | NP_651426.1 | Gene: | CG17196 / 43112 | FlyBaseID: | FBgn0039368 | Length: | 276 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016866796.1 | Gene: | ZDHHC14 / 79683 | HGNCID: | 20341 | Length: | 506 | Species: | Homo sapiens |
Alignment Length: | 243 | Identity: | 61/243 - (25%) |
---|---|---|---|
Similarity: | 91/243 - (37%) | Gaps: | 77/243 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 ILGNLLACYRTS-SAVKSLPQ---------ERQI------------PKPGTEHL--------WHY 104
Fly 105 CDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVD 169
Fly 170 VGRSFYLLHRMKAGFGNTVKS--LSYFRYVCLILNIFAL-GFPALMLRFQVQILKLNSTYYQISS 231
Fly 232 RHHDLG--------------------FRNNCQLIMGQRGLWTFISPSL 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17196 | NP_651426.1 | zf-DHHC | 103..228 | CDD:279823 | 35/127 (28%) |
ZDHHC14 | XP_016866796.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |