DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and zdhhc2

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_012820452.1 Gene:zdhhc2 / 779681 XenbaseID:XB-GENE-947256 Length:367 Species:Xenopus tropicalis


Alignment Length:170 Identity:47/170 - (27%)
Similarity:72/170 - (42%) Gaps:39/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 YCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYF-FWLTFYLAFGIFMSMATL- 166
            |||.||.:.|.|..||::|..||||.||||.:...|:|.:|:::| .:|.:.|.:.:|:....| 
 Frog   127 YCDRCQLVKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIVATDLQ 191

  Fly   167 -FV--------DVGRSFYLLHRMKAGFGNTVKSLSYFRYVCLILNIFALGFPALMLRFQVQILKL 222
             ||        |....|:::....|....:|...|.|.|.|.:                  :.|.
 Frog   192 YFVKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWL------------------VCKN 238

  Fly   223 NSTYYQISS---RH------HDLGFRNNCQLIMG-QRGLW 252
            .||.....:   ||      ..|||..|.:.:.| ::..|
 Frog   239 RSTLEAFRAPVFRHGTDKNGFSLGFSKNLRQVFGDEKKYW 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 39/134 (29%)
zdhhc2XP_012820452.1 DHHC 19..294 CDD:388695 47/170 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.