DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_081582.1 Gene:Zdhhc25 / 70073 MGIID:1917323 Length:279 Species:Mus musculus


Alignment Length:215 Identity:51/215 - (23%)
Similarity:98/215 - (45%) Gaps:23/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ILGNLLACYRTSSAVKS-LPQERQIP---KPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRD 130
            ::.:|||....:|.::: |.....:|   .||.:.: .||..|...:|..:.||.:|:.||.|.|
Mouse    73 VVFHLLASLALASHLRTMLTDPGSVPLGNPPGPDTV-SYCTDCHSAIPRTACHCTVCQRCIRKND 136

  Fly   131 HHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLSYFR 195
            |||.:...|||.:|.:||...|.|:  |:..:...|.:.:.    :|.....|..::..::|...
Mouse   137 HHCPWINNCIGEDNQKYFLLFTMYI--GLTSTHVLLLLGIP----VLCSYMRGEWDSSSTVSLPA 195

  Fly   196 YVCLILNIFALG--FPALMLRFQVQILKLNSTYYQISSRHHDLGFR----NNCQLIMGQRGLWTF 254
            .:..:|.:..:|  |..:||..|:.::..:.|..::..::...|.|    .|.:.:.|......:
Mouse   196 PILFLLLVAIMGFLFAVVMLCSQMCVIYSDKTTTELLYQNTHSGGRWSKCANMKAVCGSHVSLAW 260

  Fly   255 ISPSLRSPLPHDGTHWKIKQ 274
            :||.      |...|:|:.:
Mouse   261 LSPF------HSPEHYKVSE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 34/126 (27%)
Zdhhc25NP_081582.1 zf-DHHC 109..230 CDD:279823 34/126 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.