DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc3

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001359467.1 Gene:Zdhhc3 / 69035 MGIID:1926134 Length:332 Species:Mus musculus


Alignment Length:197 Identity:61/197 - (30%)
Similarity:91/197 - (46%) Gaps:32/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VIFLLVSTVFFFTLQVFYVAPDVHDGFMYKFFVISAIFTTYNILGNL-LACY-----------RT 80
            |.:.||....|..|.|..|..  .|   |.:.:|:.|  .:|:|..| ||.:           ..
Mouse    50 VTWFLVLYAEFVVLFVMLVPS--RD---YAYSIINGI--VFNLLAFLALASHCRAMLTDPGAVPK 107

  Fly    81 SSAVKSLPQERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNH 145
            .:|.|...:..|: |||  .:.:.|..|..:.|.|:.||::||.||.|.||||.:...|:|.||.
Mouse   108 GNATKEFIESLQL-KPG--QVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQ 169

  Fly   146 RYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLSYFRYVCLILNIFALGFPA 210
            :||...|.|:|   .:|:..|.: ||  |:.||..:..:   .|..|:.....:|| :..|.|.|
Mouse   170 KYFVLFTMYIA---LISLHALIM-VG--FHFLHCFEEDW---TKCSSFSPPTTVIL-LILLCFEA 224

  Fly   211 LM 212
            |:
Mouse   225 LL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 39/110 (35%)
Zdhhc3NP_001359467.1 DHHC 128..253 CDD:366691 39/109 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.