DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001028745.1 Gene:Zdhhc6 / 66980 MGIID:1914230 Length:413 Species:Mus musculus


Alignment Length:231 Identity:60/231 - (25%)
Similarity:89/231 - (38%) Gaps:76/231 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PKPGTEHLW-HYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYL-- 155
            |:...:.:: .||.:||....|||.||..|..|::|.||||.:...|.||.||..|   |.:|  
Mouse    89 PEKSQDSMYLQYCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHQNHASF---TLFLLL 150

  Fly   156 --------AFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVK-----------SLSYFRYVCLIL 201
                    ||...|:|.|         .|.:|:..|: ||||           .:..|.......
Mouse   151 APLGCTHAAFIFVMTMYT---------QLYNRLSFGW-NTVKIDMSAARRDPPPIVPFGLAAFAA 205

  Fly   202 NIFALGFP-------ALMLRFQVQILKLNST---------------YYQISSRH---HDLG--FR 239
            .:||||..       .::...|::|:..|.|               |||:....   :|:|  ::
Mouse   206 TLFALGLALGTTIAVGMLFFIQIKIILRNKTSIESWIEEKAKDRIQYYQLDEVFIFPYDMGSKWK 270

  Fly   240 NNCQLIMGQRGLWTFISPSLRSPLPH-DGTHWKIKQ 274
            |..|:.     .|        |.:|. ||..|.|::
Mouse   271 NFKQVF-----TW--------SGVPEGDGLEWPIRE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 46/167 (28%)
Zdhhc6NP_001028745.1 DHHC 95..241 CDD:366691 45/158 (28%)
SH3_2 317..396 CDD:369452
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.