DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc12

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_079704.2 Gene:Zdhhc12 / 66220 MGIID:1913470 Length:281 Species:Mus musculus


Alignment Length:254 Identity:58/254 - (22%)
Similarity:96/254 - (37%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLSVIFLLVSTVFFFTLQVFYVAPDVHD-GFMYKFFVISAIFTTYNILGNLLACYRTSSAVKSLP 88
            ||:.:.|::|::      :.|:|..:.| |::                       .|....:..|
Mouse    61 PLTFLLLVLSSL------LLYLAVSLMDPGYV-----------------------TTQPQPQGEP 96

  Fly    89 QERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTF 153
            :|.|............|..|..|.|.|:.||..|:.|:.:.||||.:...|:|..||..|   ..
Mouse    97 KEEQAAMVPQAVPLRRCRHCLVLQPLRARHCRDCRRCVRRYDHHCPWMENCVGERNHPLF---VA 158

  Fly   154 YLA-------FGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLSYFRYVCLILNIFALGFPAL 211
            |||       :|:.::.:      |..|:      ..:|..::|........|:|:.||| ..||
Mouse   159 YLALQLVVLLWGLCLAWS------GLQFF------QPWGLWLRSTGLLFTTFLLLSFFAL-VVAL 210

  Fly   212 MLRFQVQILKLNSTYYQISSRHH------------DLG-FRNNCQLIMG-QRGLWTFIS 256
            :|...:.::..|:|.::..|.|.            |.| .||......| ..|.|..:|
Mouse   211 LLASHLYLVARNTTTWEFISSHRIAYLRQRTSNPFDRGPTRNLAHFFCGWPSGPWETLS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 36/131 (27%)
Zdhhc12NP_079704.2 zf-DHHC <137..231 CDD:279823 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.