DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and ZDHHC6

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001338011.1 Gene:ZDHHC6 / 64429 HGNCID:19160 Length:413 Species:Homo sapiens


Alignment Length:220 Identity:59/220 - (26%)
Similarity:84/220 - (38%) Gaps:75/220 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 YCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYL----------AFG 158
            ||.:||....|||.||..|..|::|.||||.:...|.|:.||..|   |.:|          ||.
Human   100 YCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGYQNHASF---TLFLLLAPLGCIHAAFI 161

  Fly   159 IFMSMATLFVDVGRSFYLLHRMKAGFGNTVK-----------SLSYFRYVCLILNIFALGFP--- 209
            ..|:|.|         .|.||:..|: ||||           .:..|........:||||..   
Human   162 FVMTMYT---------QLYHRLSFGW-NTVKIDMSAARRDPLPIVPFGLAAFATTLFALGLALGT 216

  Fly   210 ----ALMLRFQVQILKLNST---------------YYQISSRH---HDLG--FRNNCQLIMGQRG 250
                .::...|::|:..|.|               |||:....   :|:|  :||..|:.     
Human   217 TIAVGMLFFIQMKIILRNKTSIESWIEEKAKDRIQYYQLDEVFVFPYDMGSRWRNFKQVF----- 276

  Fly   251 LWTFISPSLRSPLPH-DGTHWKIKQ 274
            .|        |.:|. ||..|.:::
Human   277 TW--------SGVPEGDGLEWPVRE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 46/166 (28%)
ZDHHC6NP_001338011.1 DHHC 95..241 CDD:396215 45/153 (29%)
SH3 317..394 CDD:418401
Di-lysine motif. /evidence=ECO:0000269|PubMed:21926431 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.