DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and zdhhc20a

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_005172729.1 Gene:zdhhc20a / 561776 ZFINID:ZDB-GENE-070424-38 Length:369 Species:Danio rerio


Alignment Length:269 Identity:64/269 - (23%)
Similarity:109/269 - (40%) Gaps:74/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VIFLLVSTVFFFTLQVFYVAPDVHDGFMYKFF-VISAIFTTYNILGNLLACYRTSSAVKSLPQER 91
            ||:|:|...|||.             ||:.:: .||:..|      |....:....|.|.|.::.
Zfish    49 VIYLVVFHAFFFM-------------FMWSYWKTISSKPT------NPSKEFCLPKAEKELYEKE 94

  Fly    92 QIPKPGTEHL-----------------WHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATC 139
            :.|:...:.|                 ..|||.||.:.|.|..||:.|..|:||.||||.:...|
Zfish    95 ERPEAQQDILKRVARELPIYTFTGSGAIRYCDRCQLIKPDRCHHCSTCDKCVLKMDHHCPWVNNC 159

  Fly   140 IGHNNHRYF-FWLTFYLAFGIFMSMATL--FVDVGRSFYLLHRMKAGFGNTVKSL--SYFRYVCL 199
            :|.:|:::| .:|.:.:.:.::::...|  |:    .|:.|.|.:|........|  ::.::   
Zfish   160 VGFSNYKFFVLFLAYSMLYCVYIAATVLQYFI----KFWTLCRRRAIEHCPENQLPDTHAKF--- 217

  Fly   200 ILNIFALGFPALMLRFQVQILKLNSTYYQISSRHH--------------------DLGFRNNCQL 244
              ::..|.|.|.|  |.:.||.|.|.:..:..::.                    .||||.|...
Zfish   218 --HVLFLFFVAAM--FFISILSLFSYHLWLVGKNRTTIEAFRAPVFRNGPDKNGFTLGFRKNITQ 278

  Fly   245 IMG-QRGLW 252
            :.| |:..|
Zfish   279 VFGDQKKYW 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 38/129 (29%)
zdhhc20aXP_005172729.1 zf-DHHC 12..309 CDD:303066 64/269 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.