DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_006539081.1 Gene:Zdhhc18 / 503610 MGIID:3527792 Length:407 Species:Mus musculus


Alignment Length:265 Identity:60/265 - (22%)
Similarity:104/265 - (39%) Gaps:77/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GH----PLSVIFLLVSTVFFFTLQVFYVA-------PDVHDGFMYKFFVISAI----FTTYNILG 72
            ||    .|:::.:|.:|:.||.....|:|       |.:  ..:..|||:|.:    ||...||.
Mouse    81 GHGGVFALTLLLILSTTILFFVFDCPYLARTLTLAIPII--AAILFFFVMSCLLQTSFTDPGILP 143

  Fly    73 NLLACYRT----------SSAVKSLPQERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCIL 127
            ....|...          ||..:..|:.|::...|......||..|:...|||:.||::|..|:.
Mouse   144 RATICEAAALEKQIDNTGSSTYRPPPRTREVMINGQTVKLKYCFTCKMFRPPRTSHCSVCDNCVE 208

  Fly   128 KRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLS 192
            :.||||.:...|:|..|:|:|:      ||.:.:|..|.|:                        
Mouse   209 RFDHHCPWVGNCVGRRNYRFFY------AFILSLSFLTAFI------------------------ 243

  Fly   193 YFRYVCLILNIFAL----GFPALMLRFQVQILKLNSTYYQISSRHHDLGFRNNCQLIMGQRGLWT 253
               :.|::.::..|    .|.:.:.:....:|:|...::.|.|             |:|..|..|
Mouse   244 ---FACVVTHLTLLSQGSNFLSALKKTPASVLELVICFFSIWS-------------ILGLSGFHT 292

  Fly   254 FISPS 258
            ::..|
Mouse   293 YLVAS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 29/128 (23%)
Zdhhc18XP_006539081.1 DHHC 183..306 CDD:366691 36/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.