DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001034432.1 Gene:Zdhhc14 / 499014 RGDID:1565877 Length:489 Species:Rattus norvegicus


Alignment Length:294 Identity:74/294 - (25%)
Similarity:116/294 - (39%) Gaps:96/294 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSVIFLLVSTVFFFTLQVFYVAP------DVHDGFMYKFFVISAIFTTYNILGNLLACYRTS-SA 83
            |::|.:||::..||.....|:|.      .|..|.:: |||          :|.||   ||| |.
  Rat    66 LTLILILVTSGLFFAFDCRYLAEKITPAIPVVGGILF-FFV----------MGTLL---RTSFSD 116

  Fly    84 VKSLPQ---------ERQI------------PKPGTEHL--------WHYCDICQKLMPPRSWHC 119
            ...||:         ||||            |.|.|:.:        ..||..|:...|||:.||
  Rat   117 PGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVKLKYCFTCKIFRPPRASHC 181

  Fly   120 ALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHR-MKAG 183
            :||..|:.:.||||.:...|:|..|:|:|:      .|.:.:|..|:|:......:::|| .:.|
  Rat   182 SLCDNCVEQFDHHCPWVGNCVGKRNYRFFY------MFILSLSFLTVFIFAFVITHVIHRSQQKG 240

  Fly   184 FGNTVKS--LSYFRYVCLILNIFA-LGFPALMLRFQVQILKLNSTYYQISSRHHDLG-------- 237
            |.:.:|.  .|....|....:::: :|...    |...::..|.|      .:.|:.        
  Rat   241 FLDALKDSPASVLEAVICFFSVWSIIGLSG----FHTYLISSNQT------TNEDIKGSWSNKRG 295

  Fly   238 ------------FRNNCQLIMGQRGLWTFISPSL 259
                        |.|.|..:.|.      |||||
  Rat   296 KENYNPYSYGNIFTNCCVALCGP------ISPSL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 35/128 (27%)
Zdhhc14NP_001034432.1 DHHC 164..287 CDD:396215 36/138 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.