DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and zdhhc7

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001002602.1 Gene:zdhhc7 / 436875 ZFINID:ZDB-GENE-040718-346 Length:299 Species:Danio rerio


Alignment Length:196 Identity:53/196 - (27%)
Similarity:92/196 - (46%) Gaps:22/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSVIFLLVSTVFFFTLQVFYVAPDVHDGFMYKFFVISAIFTTYNILGNLLACYRTSSAVKSLPQE 90
            ::.:.||.|..|::||         .:|..:.|..:.|:.:....:..........:|.|...:.
Zfish    56 VNFVMLLPSKNFWYTL---------INGVAFNFLAVLALTSHLRTMLTDPGAVPKGNATKEYMES 111

  Fly    91 RQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYL 155
            .|: |||  .:.:.|..|..:.|.|:.||::||.||.|.||||.:...|:|.||.|:|...|.|:
Zfish   112 LQL-KPG--EVIYKCPKCCSIKPERAHHCSICKRCIRKMDHHCPWVNNCVGENNQRFFVLFTMYI 173

  Fly   156 AFGIFMSMATLFVDVGRSFYLLHRMK----AGFGNTVKSLSYFRYVCLILNIFALGFPALMLRFQ 216
            |   .:|:..|.:. |..|:...:::    :.|...| ::....::||...:| |.|.|:|...|
Zfish   174 A---SISLHALCLS-GFHFFTCVKVQWNECSDFSPPV-AVMLLIFLCLEALLF-LTFTAVMFGTQ 232

  Fly   217 V 217
            :
Zfish   233 I 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 38/119 (32%)
zdhhc7NP_001002602.1 DHHC 122..249 CDD:396215 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.