DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and CG5880

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster


Alignment Length:232 Identity:54/232 - (23%)
Similarity:89/232 - (38%) Gaps:74/232 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 CDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFF-WLT-------FYLAFGIFM 161
            |..|....|||:.||::|..||||.||||.:...|:|:.|||||| ::|       |.:.||:.:
  Fly   139 CGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEI 203

  Fly   162 SMATLFVDVGRSFYLLHRMKAGFGNTVK------------------------------------- 189
            ....|::|.|.::..:..::   |..||                                     
  Fly   204 GHKYLWLDHGENWTEIEPLE---GQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDA 265

  Fly   190 -------SLSYFRY----VCLILNIFALGFPALMLRFQVQI--------LKLNSTYYQISSRHHD 235
                   :|.:..:    |.|.|...::....|:.|.:..:        .|.:....:|....::
  Fly   266 ASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAHINEAERKRHLQQQRIYINPYN 330

  Fly   236 LGFRNNCQLIMG---QRGLW-TFISPSLRSPLPHDGT 268
            .|.:.|.:|.:|   .|..| |.:.||...|   :||
  Fly   331 FGTKKNWKLFLGLVRGRSFWRTVLLPSWHKP---EGT 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 41/186 (22%)
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.