DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and CG4483

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster


Alignment Length:308 Identity:66/308 - (21%)
Similarity:114/308 - (37%) Gaps:73/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCI-VNDWCREYANLYPKKAVSIGHPLSVIFLLVSTVFFFTLQVFYVAPDVHDGFMYKFFVISAI 64
            ||| :.|..|.:.:..|   :::   |::..::..||.......:.....:.....|....|...
  Fly     1 MCIKLKDDLRRFIHWGP---ITL---LTLTLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTF 59

  Fly    65 FTTYNILGNLLACYRTSSAVKSLPQERQIPKPGTEHL-WH-----------YCDICQKLMPPRSW 117
            .|.||.:.:|:.                  .||...| ||           :|..|.....|||.
  Fly    60 GTLYNFIRSLMV------------------GPGFVPLKWHPQLTKDKMFLQFCTRCNGYKAPRSH 106

  Fly   118 HCALCKCCILKRDHHCIFAATCIGHNNHRYF-FWLTFYLA----FGIFMSMATLFVDVGRSFYLL 177
            ||..|..|::|.||||.:..||:|.:|...| ::|.|:::    .||.:..|.:     |.  :.
  Fly   107 HCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVI-----RG--IK 164

  Fly   178 HRMKAGFGNTVKSLSYFRYVCLILNIFALGF-------PALMLRFQVQILKLNSTYYQ--ISSRH 233
            .|....:|....:..:.....|:..:|:||.       ...:|..|::.:..|.|..:  |..: 
  Fly   165 KRWLIRYGLRHMATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKK- 228

  Fly   234 HDLGFRNNCQLIMGQRGLWTFISP-------SLRSPL--PHDGTHWKI 272
              ..||.|.   ..::|:..|:.|       ::|...  ..||..|.:
  Fly   229 --AAFRRNA---YPRKGIKPFVYPYNLGWKTNMREVFFSTGDGISWPV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 36/147 (24%)
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 35/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467517
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.