DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and CG17287

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster


Alignment Length:208 Identity:57/208 - (27%)
Similarity:91/208 - (43%) Gaps:42/208 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 AVKSLPQERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRY 147
            |.::||    |.....:.|..||..|..:.|.|:.||..|..|:||.||||.:...|:..:|.:|
  Fly   109 AARNLP----IATCTIDGLVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKY 169

  Fly   148 FFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTV----KSLSYFRY-VCLILNIFALG 207
            |....||.....|.....:..|:    ||:    .||..|.    .|.:..:| ||::.|||.  
  Fly   170 FILFLFYAEVYCFYLFCVMVYDL----YLI----CGFEVTALKNQHSWNILQYLVCILFNIFT-- 224

  Fly   208 FPALMLRFQVQILKLN----------STYYQISSRHH---DLGFRNNCQLIMGQRG-LWTFISPS 258
                ::.:.|.:|.::          :||:.:..:::   :||:..|.:.:.|.:. ||.|...|
  Fly   225 ----VIMYTVSLLNVSRNRTTMESAYATYFLLGGKNNNGFNLGYFVNFRDLYGDKWYLWPFPIFS 285

  Fly   259 LRS-----PLPHD 266
            .|.     ||.||
  Fly   286 SRGDGFSFPLAHD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 39/139 (28%)
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 37/131 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467489
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.