DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and CG8314

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster


Alignment Length:246 Identity:59/246 - (23%)
Similarity:97/246 - (39%) Gaps:77/246 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IFTTYN-ILGNLLACYRTSSAVKSLPQERQIPKPGT------------------EHLWHYCDICQ 109
            :|:|.| |:...||....:|.::::     :..||.                  ..:::.|..|.
  Fly    68 VFSTINMIIFQALAFLAFASHIRTM-----LSDPGAVPRGNATKEMIEQMGYREGQMFYKCPKCC 127

  Fly   110 KLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSF 174
            .:.|.|:.||::|:.||.|.||||.:...|:|.||.:||...|||:|   .:|:.|||:      
  Fly   128 SIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIA---SISVHTLFL------ 183

  Fly   175 YLLHRMKAGFGNTVKS----------------LSYFRYVCLILNIFALGFPALMLRFQ------- 216
                 :...|...||:                |.:..:..|:..||.:    :||..|       
  Fly   184 -----VLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTI----IMLATQLTAILND 239

  Fly   217 ---VQILKLNSTYYQISSRHHDLGFRNNCQLIMGQRGL-W--TFISPSLRS 261
               ::.||.....:...||      ..:.|.:.|:..| |  .|..||.|:
  Fly   240 QTGIEQLKKEEARWAKKSR------LKSIQSVFGRFSLAWFSPFTEPSCRT 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 40/150 (27%)
CG8314NP_611070.1 DHHC 122..249 CDD:396215 40/144 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467534
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.