DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc17

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001034429.1 Gene:Zdhhc17 / 366889 RGDID:1595790 Length:622 Species:Rattus norvegicus


Alignment Length:313 Identity:74/313 - (23%)
Similarity:122/313 - (38%) Gaps:90/313 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KKAVSIGHPLSVIFL---------------------LVSTVFFFTLQVF------------YVAP 48
            ::.|.:|.|..||:|                     :.:||.|.:...|            |:|.
  Rat   292 RQKVMLGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPLGIYLAT 356

  Fly    49 DVHDGFMYKFFV-ISAIFTTYN----------ILGNLLAC-YRTSSAVKSLP--------QER-- 91
                    ||:: ::..|..:|          .|.|.:|. |....:.||.|        |::  
  Rat   357 --------KFWMYVTWFFWFWNDLSFLSIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQKKKT 413

  Fly    92 --QIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFY 154
              ::.:.|:..|..:|..|....|.||.||.:|..||.|.||||.:...|:...|||||..   |
  Rat   414 IVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVCAGNHRYFMG---Y 475

  Fly   155 LAFGIFMSMATLFVDVGRSFYLLH----RMKAGFGNTVKSL---SYFRYVCLILNIFALGFPALM 212
            |.|.:||....::..|  |::.||    ..|.||...:..:   |.:.:...:.::|...:.|::
  Rat   476 LFFLLFMICWMIYGCV--SYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVFHFMWVAVL 538

  Fly   213 LRFQVQILKLNSTYYQISSRHHDLGFRNNCQLIMGQRGLWTFISPSLRSPLPH 265
            |..|:         |||:.    ||...|.::...:...:...:.|:.||..|
  Rat   539 LMCQM---------YQITC----LGITTNERMNARRYKHFKVTTTSIESPFNH 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 38/131 (29%)
Zdhhc17NP_001034429.1 Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000250|UniProtKB:Q80TN5 1..295 0/2 (0%)
Ank_4 <60..100 CDD:290365
ANK 77..192 CDD:238125
ANK repeat 79..110 CDD:293786
Ank_2 84..177 CDD:289560
ANK repeat 112..144 CDD:293786
ANK 143..267 CDD:238125
ANK repeat 146..177 CDD:293786
Ank_2 151..245 CDD:289560
ANK repeat 179..211 CDD:293786
ANK repeat 214..245 CDD:293786
zf-DHHC 428..558 CDD:279823 44/147 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.