DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc12

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001013257.1 Gene:Zdhhc12 / 366014 RGDID:1306593 Length:267 Species:Rattus norvegicus


Alignment Length:182 Identity:49/182 - (26%)
Similarity:80/182 - (43%) Gaps:35/182 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ILGNLLACYRTS----SAVKSLPQERQIPK-------PGTEHLWHYCDICQKLMPPRSWHCALCK 123
            :||:||.....|    ..|.:.||.::.||       |....| ..|..|..|.|.|:.||..|:
  Rat    54 VLGSLLLYLAVSLMDPGYVTAQPQPQEEPKEEQTAMVPQAIPL-RRCRYCLVLQPLRARHCRECR 117

  Fly   124 CCILKRDHHCIFAATCIGHNNHRYFFWLTFYLA-------FGIFMSMATLFVDVGRSFYLLHRMK 181
            .|:.:.||||.:...|:|..||..|   ..|||       :|::::.:      |..|:      
  Rat   118 RCVRRYDHHCPWMENCVGERNHPLF---VAYLALQLVVLLWGLYLAWS------GLQFF------ 167

  Fly   182 AGFGNTVKSLSYFRYVCLILNIFALGFPALMLRFQVQILKLNSTYYQISSRH 233
            ..:|..::|........|:|:.||| ..:|:|...:.::..|:|.::..|.|
  Rat   168 QPWGLWLRSTGLLFTTFLLLSFFAL-VVSLLLASHLYLVARNTTTWEFISSH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 35/131 (27%)
Zdhhc12NP_001013257.1 DHHC <123..217 CDD:396215 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.