DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc5

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001034427.1 Gene:Zdhhc5 / 362156 RGDID:1589737 Length:715 Species:Rattus norvegicus


Alignment Length:247 Identity:58/247 - (23%)
Similarity:94/247 - (38%) Gaps:41/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PKKAVSIGHPLSVIFLLVSTVFFF-------TLQVFYVAPDVHDGFMYKFFVISAIFTTYNILGN 73
            |.|.|.:.  .:.|||:.:|..||       :|.|....| :::..|:.|.:.:....|:...|.
  Rat    11 PSKYVPVS--AAAIFLVGATTLFFAFTCPGLSLDVSPAVP-IYNAIMFLFVLANFSMATFMDPGI 72

  Fly    74 LLACYRTSSAVKSL--PQERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFA 136
            ..............  |..:.:...|.:....:|..|:...|||..||::|..|:.:.||||.:.
  Rat    73 FPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWV 137

  Fly   137 ATCIGHNNHRYFFWLTFYLA---FGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLSYFR--- 195
            ..|||..|:||||.....|.   .|:|        ..|..:.|.|         ::.||..|   
  Rat   138 NNCIGRRNYRYFFLFLLSLTAHIMGVF--------GFGLLYVLCH---------IEELSGVRTAV 185

  Fly   196 --YVCLILNIFALGFPALMLRFQVQILKLNSTYYQISSRHHDLG---FRNNC 242
              .|..:..:|.:....|.....|.:.:..:|..|::.:... |   |.|.|
  Rat   186 TMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRG-GVNPFTNGC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 35/132 (27%)
Zdhhc5NP_001034427.1 zf-DHHC 99..224 CDD:279823 36/141 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.