Sequence 1: | NP_651426.1 | Gene: | CG17196 / 43112 | FlyBaseID: | FBgn0039368 | Length: | 276 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001356957.1 | Gene: | Patsas / 34634 | FlyBaseID: | FBgn0029137 | Length: | 613 | Species: | Drosophila melanogaster |
Alignment Length: | 222 | Identity: | 56/222 - (25%) |
---|---|---|---|
Similarity: | 82/222 - (36%) | Gaps: | 65/222 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 YKFFVISAIFTTYNILGNLLAC------------------------------YRTSSAVKSLPQE 90
Fly 91 RQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYL 155
Fly 156 A----FGIFMSMATLFVDVGRSFYLLHRMKA----GFG---------------NTVKSLSYFRYV 197
Fly 198 CL------ILNIFALGFPAL-MLRFQV 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17196 | NP_651426.1 | zf-DHHC | 103..228 | CDD:279823 | 40/145 (28%) |
Patsas | NP_001356957.1 | ANKYR | 113..306 | CDD:223738 | |
ANK repeat | 148..181 | CDD:293786 | |||
ANK repeat | 187..214 | CDD:293786 | |||
ANK repeat | 216..247 | CDD:293786 | |||
ANK repeat | 249..280 | CDD:293786 | |||
ANK repeat | 282..314 | CDD:293786 | |||
Ank_4 | 283..336 | CDD:316185 | |||
DHHC | 455..567 | CDD:334580 | 28/111 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45467582 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |