DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc23

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001007461.1 Gene:Zdhhc23 / 332175 MGIID:2685625 Length:425 Species:Mus musculus


Alignment Length:309 Identity:77/309 - (24%)
Similarity:123/309 - (39%) Gaps:99/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TVFFFTLQVFYVAPDVHDGFMYKFFVISAI-----------FTTYNILGNLLACYRT-------- 80
            |:||.:|.:|.:      |:||..|:...:           ..|..:|..|||.||.        
Mouse   132 TLFFLSLGLFSL------GYMYYVFLREVVPQGRVGPTQLALLTCGLLLILLALYRAKKNPGYLS 190

  Fly    81 -----SSAVKSLP----QERQIPKPGTE-----------------------------HLWHYCDI 107
                 |::....|    ||:....|||:                             ..|  |..
Mouse   191 NDKSPSNSQIECPVKKGQEKTKGFPGTDASGSLNNRTLKDDVRGSSRVGLDSPAKVKEDW--CAK 253

  Fly   108 CQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFW-LTFYL---AFGIFMSMATLFV 168
            ||.:.|.|:|||.:|..|:.:.||||::..:|:|.:||:.|.. |:.:|   .:||.:::.|:..
Mouse   254 CQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALSIFLLTSVYGISLTLNTICR 318

  Fly   169 DVGRS-FYLLHRMKAGFGNTVKSLSYFRYVCLILNIFALGFPALMLRFQVQILKLNSTYYQISSR 232
            |  || |..|......:.|...:||   :.|:..::......|.:  |.:|::.::   |.::.|
Mouse   319 D--RSLFTALFYCPGVYANYSSALS---FTCVWYSVIITAGMAYI--FLIQLINIS---YNVTER 373

  Fly   233 ------HHDLGFRNNCQLIM--GQ--RGLWTFISPSLRSPLPHD--GTH 269
                  ....|.|..|.||:  ||  ||.       ||:.|...  |||
Mouse   374 EVQQALRQKTGRRLLCGLIVDTGQYNRGF-------LRNWLQFSTLGTH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 36/129 (28%)
Zdhhc23NP_001007461.1 DHHC 248..374 CDD:396215 38/137 (28%)
Interaction with NOS1. /evidence=ECO:0000250 422..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.