DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and CG17075

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:347 Identity:68/347 - (19%)
Similarity:111/347 - (31%) Gaps:126/347 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HPLSVIFLLVSTVFFFTLQVFYVAPDVH---DGFMYKFFVISAIFTTYNILGNLLACYRTSSAVK 85
            |||.:...|| .:.|.....:.:.|..|   .|.:|.  :|:.::..:  :.:.|....|..|.|
  Fly   111 HPLQIFGWLV-LLLFGVASYWVLIPAFHARIQGPLYG--LITGLYLVH--IASHLTALLTDPADK 170

  Fly    86 SLPQ----ERQIPKPGTEHLWHY-----CDICQ-KLMPPRSWHCALCKCCILKRDHHCIFAATCI 140
            .|.:    :|.:|:.......|.     |.:|. :....|:.||::|..|:.|.||||.:...||
  Fly   171 ELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCI 235

  Fly   141 GHNNHRYFF-----------------------------WLTFY---------LAFGIF------M 161
            |..|:..|.                             ||:||         :..|.|      :
  Fly   236 GSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYWCPTESSHTIESGDFINITLSL 300

  Fly   162 SMATLFV--------DVGRSFY--------------LLHRMKA---------------------- 182
            |..|:.:        ||.:..:              ||....|                      
  Fly   301 SNGTMMLIEQHTSEEDVHQEMWDEEQANMTISTLPTLLENFTAIIEASATRPGISPTNHTETQPV 365

  Fly   183 ----GFGNTVKSLSYFRYVCLILNIFALGFPALMLR---FQVQILKLNSTYYQISSRHHDLGFRN 240
                |...|:     |.::..:|.:.|.....|:|.   |.:.|..|..|.|:....|.......
  Fly   366 VTGIGLNETI-----FMFLLGVLGLLAAVSAGLLLHLCFFHIYISFLGLTTYEYIRNHRQAQDAK 425

  Fly   241 NCQLIMGQRGLWTFISPSLRSP 262
            ..||:.|        :|.:|:|
  Fly   426 TKQLLEG--------APGVRAP 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 42/225 (19%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.