DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster


Alignment Length:268 Identity:66/268 - (24%)
Similarity:106/268 - (39%) Gaps:68/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VIFLLVSTVFFFTLQVFYVAPD----VHDGFMYKFFVISAIFTTYNILGNLLACYRTSSAV-KSL 87
            ::.||.:.:|||....|||...    .:.| :..|||: |.||        ||.:.....: |:.
  Fly    18 IVLLLTTFLFFFYPCQFYVKSHPWVLAYQG-VITFFVL-ANFT--------LATFMDPGIIPKAS 72

  Fly    88 PQ---ERQIPKP--------GTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIG 141
            |.   |.::..|        |......:|..|:...|||..||::|..||...||||.:...|||
  Fly    73 PDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIG 137

  Fly   142 HNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLSYFRYVCLILNIFAL 206
            ..|:|:||   |:|. .:.:.|.::|     |..|::        .:|.:...:....|:.|..:
  Fly   138 RRNYRFFF---FFLV-SLSIHMLSIF-----SLCLVY--------VLKIMPNIKDTAPIVAIILM 185

  Fly   207 GFPALMLRFQVQILKLNSTYYQISSRHHDLGFRNNCQLIMGQ---------RGLWTFIS------ 256
            |...::   .:.|..|...:..:.||.     |...:.:.|:         ||.|....      
  Fly   186 GLVTIL---AIPIFGLTGFHMVLVSRG-----RTTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGP 242

  Fly   257 --PSLRSP 262
              |||.:|
  Fly   243 QYPSLLNP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 33/124 (27%)
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 36/149 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.