DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc20

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_006252134.1 Gene:Zdhhc20 / 305923 RGDID:1305755 Length:444 Species:Rattus norvegicus


Alignment Length:285 Identity:65/285 - (22%)
Similarity:108/285 - (37%) Gaps:80/285 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VIFLLVST-----------VFFFTLQVFYVAPDVHDGFMYKFFVISAIFTT--------YNILGN 73
            |:.|.|||           |:.....:|:|.      |::.:::  .|||:        |     
  Rat    93 VVELCVSTVSRTGEKGKTVVYLVAFHLFFVM------FVWSYWM--TIFTSPASPSKEFY----- 144

  Fly    74 LLACYRTSSAVKSLPQERQ------------IPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCI 126
             |:........|...||||            :..........||:.||.:.|.|:.||:.|..|:
  Rat   145 -LSNSEKERYEKEFSQERQQDILRRAARDLPVYTTSASKAIRYCEKCQLIKPDRAHHCSACDRCV 208

  Fly   127 LKRDHHCIFAATCIGHNNHRYF-FWLTFYLAFGIFMSMATL--FVDVGRSFYLLHRMKAGFG--- 185
            ||.||||.:...|:|..|:::| .:|.:.|.:.:|::...|  |:    .|:.|.|.|:...   
  Rat   209 LKMDHHCPWVNNCVGFTNYKFFMLFLLYSLLYCLFVAATVLEYFI----KFWTLCRRKSTENCPK 269

  Fly   186 --NTVKSLSYFRYVCLILNIFALGFPALMLRFQVQILKLNSTY--------------------YQ 228
              .||.:....::.....::..|.|.:.|  |.|.:|.|.|.:                    |.
  Rat   270 NEPTVLTFPSAKFPSAKFHVLFLFFVSAM--FFVSVLSLFSYHCWLVGKNRTTIESFRAPMFSYG 332

  Fly   229 ISSRHHDLGFRNNCQLIMG-QRGLW 252
            |......||...|.:.:.| ::..|
  Rat   333 IDGNGFSLGCSKNWRQVFGDEKKYW 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 39/152 (26%)
Zdhhc20XP_006252134.1 zf-DHHC 75..380 CDD:303066 65/285 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.