DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001013141.1 Gene:Zdhhc4 / 304291 RGDID:1308389 Length:343 Species:Rattus norvegicus


Alignment Length:288 Identity:60/288 - (20%)
Similarity:101/288 - (35%) Gaps:88/288 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HP--LSVIFLLVSTVFF-FTLQVFYVAPDVHDGFMYKFFVISAIFTTYNILGNLLACYR-----T 80
            ||  |::..||...|:. :|.:||....::.  |.....::..:..:.|::...|.|..     |
  Rat    65 HPAFLALHLLLQGLVYAEYTYEVFSYCRELE--FSLPCLLLPYVLLSVNLVFFTLTCSTNPGTIT 127

  Fly    81 SSAVKSLPQ-----ERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCI 140
            .:.|..|.|     |...||...      |..|....|.||.||.:|..|:.:.||||::...||
  Rat   128 KTNVLLLLQVYEFDEVMFPKNSR------CSTCDLRKPARSKHCRVCDRCVHRFDHHCVWVNNCI 186

  Fly   141 GHNNHRYF--FWLTFYLAFGIFMSMATLFV----------------DVGR-----SFYLLHRMKA 182
            |..|..||  :.||...:......::..|:                |:||     :.:|:..:..
  Rat   187 GAWNTGYFLIYLLTLTASAATIAILSAAFLLRLVAVSNLYQETYLDDLGRFQAVDTGFLIQHLFL 251

  Fly   183 GFGNTVKSLSYFRYVCLILNIFALGFPALMLRFQVQILKLNST---YYQISSRHHDLGFRNNCQL 244
            .|...:..|.:    .::|::...|:    |.|.:.:...|.|   :|                 
  Rat   252 AFPRIIFLLGF----VIVLSLLLAGY----LCFALYLAATNQTTNEWY----------------- 291

  Fly   245 IMGQRGLWTFISPSLRSPLPHDGTHWKI 272
                ||.|.:..            ||.:
  Rat   292 ----RGDWAWCQ------------HWPL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 34/150 (23%)
Zdhhc4NP_001013141.1 zf-DHHC 151..292 CDD:279823 35/169 (21%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.