DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc9

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001034105.2 Gene:Zdhhc9 / 302808 RGDID:1561389 Length:364 Species:Rattus norvegicus


Alignment Length:279 Identity:65/279 - (23%)
Similarity:107/279 - (38%) Gaps:69/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IFLLVST-VFFFTLQVFYVAPDVHDGFMYKFFVISAIFTTYNILGNLLACYRTSSA-----VKSL 87
            :||::.| ..||..:..|:|..:....        .:|.....|.::....|||.:     .::|
  Rat    42 LFLILGTCTLFFAFECRYLAVQLSPAI--------PVFAAMLFLFSMATLLRTSFSDPGVIPRAL 98

  Fly    88 PQER-----------------QIPKPGTEHL--------WHYCDICQKLMPPRSWHCALCKCCIL 127
            |.|.                 |.|.|..::.        ..||..|:...|||:.||::|..|:.
  Rat    99 PDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVE 163

  Fly   128 KRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYL-LHRMKAGFGNTVKSL 191
            :.||||.:...|:|..|:|||:      .|.:.:|:.|::|......|: |..:|.||..|:|..
  Rat   164 RFDHHCPWVGNCVGKRNYRYFY------LFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKET 222

  Fly   192 SYFRYVCLILNIFALGFPALMLRFQVQILKLNSTYYQISSRHHDLGFRNNCQLIMGQRGLWTFIS 256
            .......||. .|.|.....:..|...::.||.|      .:.|:            :|.||. .
  Rat   223 PGTVLEVLIC-FFTLWSVVGLTGFHTFLVALNQT------TNEDI------------KGSWTG-K 267

  Fly   257 PSLRSPLPHDGTHWKIKQC 275
            ..:::|..|...   :|.|
  Rat   268 NRVQNPYSHGNI---VKNC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 39/125 (31%)
Zdhhc9NP_001034105.2 zf-DHHC 138..261 CDD:279823 40/147 (27%)
ANXA2R <284..>343 CDD:292349 65/279 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.