DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001034422.1 Gene:Zdhhc25 / 300323 RGDID:1598341 Length:279 Species:Rattus norvegicus


Alignment Length:209 Identity:57/209 - (27%)
Similarity:101/209 - (48%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NLLACYRTSSAVKS-LPQERQIP---KPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHC 133
            :|||.....|.::: |.....:|   :||.:.: .||..|:..:|.|:.|||:||.||.|.||||
  Rat    76 HLLASLALVSHLRTMLTDPGSVPLGNRPGPDTV-SYCPDCRSAIPKRAAHCAVCKRCIRKNDHHC 139

  Fly   134 IFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLSYFRYVC 198
            .:...|:|.:|.:||  |.|.:..|:..:...|.:.:.    :|.....|..::..|:|....:.
  Rat   140 PWVNNCVGEDNQKYF--LLFIMYIGLSGTHVLLLLGIP----VLCSYARGEWDSSSSVSPPAPIL 198

  Fly   199 LILNIFALGF--PALMLRFQVQILKLNSTYYQISSRH-HDLGFRNNCQLIMGQRGLWTFISPSLR 260
            .:|.:..:||  .::||..|:..:..:.|..::..:: |..|.|..|..:....|  :.||.:..
  Rat   199 FLLLVALMGFVLSSVMLCTQMCTIYTDKTTTELLYQNTHSPGNRAKCANLKAICG--SHISLAWL 261

  Fly   261 SPLPHDGTHWKIKQ 274
            ||. |...|:|:.:
  Rat   262 SPF-HSPEHYKMSE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 37/126 (29%)
Zdhhc25NP_001034422.1 zf-DHHC 109..230 CDD:279823 37/126 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.