DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001034348.1 Gene:Zdhhc19 / 288045 RGDID:1309014 Length:359 Species:Rattus norvegicus


Alignment Length:256 Identity:67/256 - (26%)
Similarity:99/256 - (38%) Gaps:59/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLSVIFLLVSTVFFFTLQVF------------------YVAPDVHDG-FMYKFF-VISAIFTTYN 69
            |||..|..:...|..:|.||                  :|.|.|... |:..|| ::|..|:...
  Rat    24 PLSWFFPSLFAAFNVSLLVFLSGLFFGFPCRWLVQNGEWVFPAVTGPLFILTFFSLVSLNFSDPG 88

  Fly    70 IL--GNLLACYRTSSAVKSLPQERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHH 132
            ||  |::....||...|:...:..::         .:|..|....|||::||..|..|:...|||
  Rat    89 ILHRGSVSEDPRTVHVVRVNQRAFRL---------EWCPKCLFHRPPRTYHCPWCNICVEDFDHH 144

  Fly   133 CIFAATCIGHNNHRYFFWLTFYLAF--GIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLSYFR 195
            |.:...||||.|.|.|..|..:|..  |..:....:|        |:|.....|       |..:
  Rat   145 CKWVNNCIGHRNFRLFVLLILFLCLYSGALLVTCLMF--------LIHTSHLPF-------SLDK 194

  Fly   196 YVCLILNIFALGF--PALMLRFQVQILKLN--STYYQISSRHH------DLGFRNNCQLIM 246
            .:.:::.:.|.||  | |.|...:|.|.::  ...|:...|.|      |.||..|..|.|
  Rat   195 AMAILVAVPAAGFLIP-LFLLMLIQALSVSRAERSYESKCRDHEEYNPFDQGFAKNWYLTM 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 36/130 (28%)
Zdhhc19NP_001034348.1 zf-DHHC 112..230 CDD:279823 36/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.