DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and erf2

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_595766.1 Gene:erf2 / 2541058 PomBaseID:SPBC3H7.09 Length:350 Species:Schizosaccharomyces pombe


Alignment Length:238 Identity:58/238 - (24%)
Similarity:101/238 - (42%) Gaps:55/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSVIFLLVSTVFFFTLQVF----YVAPDVHDGFMYKF-FVISAIF------------TTYNILGN 73
            :|:..|::..|.||....|    :|:|.|...|.|.: ..:.::|            ..|::   
pombe    89 ISLFALILPGVLFFIFSAFWLWHHVSPAVPITFAYLYALAVVSMFKCSTADPGILPRNAYSL--- 150

  Fly    74 LLACYRTSSAVKSLPQERQIPKPGTEH-----LWHYCDICQKLMPPRSWHCALCKCCILKRDHHC 133
               .|..:.....:|::|::....|..     ...||..|....|||:.||.||..|:...||||
pombe   151 ---TYNPAHPWSVIPEDRKVLVGSTRSDSVFVNTVYCHTCHLYRPPRASHCHLCDNCVEYLDHHC 212

  Fly   134 IFAATCIGHNNHRYFF-WLTFYLAFGIFMSMATLFVDVGRSFY---------LLHRMKAGFGNTV 188
            |:..||||..|:||:| :|...:...::::....:..:| ||:         .|.|..||     
pombe   213 IWLNTCIGRRNYRYYFIFLLSVVLSALYLTGLGFYTSIG-SFHESTDTNFAAHLRRPWAG----- 271

  Fly   189 KSLSYFRYVCLILNIF-ALG--FPALMLRFQVQILKLNSTYYQ 228
              :|:|      |.|: |||  .|.::..:|..::.:....::
pombe   272 --VSFF------LGIYGALGAILPGILFCYQCYLISVGQNVHE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 41/137 (30%)
erf2NP_595766.1 COG5273 57..350 CDD:227598 58/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.