DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:287 Identity:70/287 - (24%)
Similarity:107/287 - (37%) Gaps:79/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLSVIFLLVSTVFFFTLQVFYVAPD---VHDG-----------FMYKFF-VISAIFTTYNILGNL 74
            |.||......|:..|...:|:..|.   |.:|           |:..|| ::|..|:...||   
Mouse    26 PSSVFAAFNVTLLLFLSGLFFGFPCRWLVQNGEWAFPAITGPLFILTFFSLVSLNFSDPGIL--- 87

  Fly    75 LACYRTSSAVKSLPQERQIPKPGTEHL---------WHYCDICQKLMPPRSWHCALCKCCILKRD 130
               :|.|:.          ..|.|.|:         ..:|..|....|||::||..|..|:...|
Mouse    88 ---HRGSTK----------EDPMTVHVVRVNQRAFRLEWCPKCLFHRPPRTYHCPWCNICVEDFD 139

  Fly   131 HHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLSYFR 195
            |||.:...||||.|.|.|..|...|.......:.|....:.|:.:|...:..|            
Mouse   140 HHCKWVNNCIGHRNFRLFMLLVLSLCLYSGALLVTCLTFLFRTRHLPFSLDKG------------ 192

  Fly   196 YVCLILNIFALGF--PALMLRFQVQILKLN--STYYQISSRHH------DLGFRNNCQLIMGQRG 250
             :.:::.:.|.||  | |.|...:|.|.::  .:.|:...|:|      |.||..|..|.|    
Mouse   193 -MAILVAVPAAGFLIP-LFLLLLIQALSVSRAESSYESKCRYHPEYNPFDQGFAKNWYLAM---- 251

  Fly   251 LWTFISPS-------LRSPLPHDGTHW 270
             :..:.|:       |:.|:   ||.|
Mouse   252 -FAPLGPNYMSEVVCLQRPV---GTAW 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 34/128 (27%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 23/71 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347 70/287 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.