Sequence 1: | NP_651426.1 | Gene: | CG17196 / 43112 | FlyBaseID: | FBgn0039368 | Length: | 276 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_666185.3 | Gene: | Zdhhc14 / 224454 | MGIID: | 2653229 | Length: | 489 | Species: | Mus musculus |
Alignment Length: | 294 | Identity: | 74/294 - (25%) |
---|---|---|---|
Similarity: | 116/294 - (39%) | Gaps: | 96/294 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 LSVIFLLVSTVFFFTLQVFYVAP------DVHDGFMYKFFVISAIFTTYNILGNLLACYRTS-SA 83
Fly 84 VKSLPQ---------ERQI------------PKPGTEHL--------WHYCDICQKLMPPRSWHC 119
Fly 120 ALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHR-MKAG 183
Fly 184 FGNTVKS--LSYFRYVCLILNIFA-LGFPALMLRFQVQILKLNSTYYQISSRHHDLG-------- 237
Fly 238 ------------FRNNCQLIMGQRGLWTFISPSL 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17196 | NP_651426.1 | zf-DHHC | 103..228 | CDD:279823 | 35/128 (27%) |
Zdhhc14 | NP_666185.3 | zf-DHHC | 164..289 | CDD:307600 | 36/140 (26%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 434..454 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |