DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and Zdhhc7

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_596885.1 Gene:Zdhhc7 / 170906 RGDID:620205 Length:308 Species:Rattus norvegicus


Alignment Length:225 Identity:53/225 - (23%)
Similarity:90/225 - (40%) Gaps:39/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCIVNDWCR-EYANLYPKKAVSIGHPLSVIFLLVSTVFFFTLQVFYVAPDVHDGFMYKFFVISAI 64
            :|.|..|.. .||:..          ::.:.||.|..|:::         |.:|.::....:.|:
  Rat    49 VCAVMTWLLVVYADFV----------VTFVMLLPSKDFWYS---------VVNGVLFNCLAVLAL 94

  Fly    65 FTTYNILGNLLACYRTSSAVKSLPQERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKR 129
            .:....:..........:|.|...:..|: |||  .:.:.|..|..:.|.|:.||::||.||.|.
  Rat    95 SSHLRTMLTDPGAVPKGNATKEYMESLQL-KPG--EVIYKCPKCCCIKPERAHHCSICKRCIRKM 156

  Fly   130 DHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLSYF 194
            ||||.:...|:|..|.|:|...|.|:|    :|.....:..|..|....|     |...:...:.
  Rat   157 DHHCPWVNNCVGEKNQRFFVLFTMYIA----LSSIHALILCGLQFISCVR-----GQWTECSDFS 212

  Fly   195 RYVCLILNIFA-------LGFPALMLRFQV 217
            ..:.:||.:|.       ..|.|:|...|:
  Rat   213 PPITVILLVFLCLEGLLFFTFTAVMFGTQI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 35/122 (29%)
Zdhhc7NP_596885.1 DHHC 131..258 CDD:396215 35/121 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.