DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and ZDHHC15

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_659406.1 Gene:ZDHHC15 / 158866 HGNCID:20342 Length:337 Species:Homo sapiens


Alignment Length:312 Identity:69/312 - (22%)
Similarity:115/312 - (36%) Gaps:111/312 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YANLYPKKAVSIGHPL-SVIFLLV---STVFF--------FTL-----QVFYVA----------- 47
            ||.::....|::..|. .||:|::   ..|||        |||     |.|:::           
Human    37 YAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEE 101

  Fly    48 -PDVHDGFMYKFFVISAIFTTYNILGNLLACYRT-SSAVKSLPQERQIPKPGTEHLWHYCDICQK 110
             |:|....:........::|            || |.||:                  :||.|..
Human   102 RPEVQKQMLVDMAKKLPVYT------------RTGSGAVR------------------FCDRCHL 136

  Fly   111 LMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFY 175
            :.|.|..||::|..|:||.||||.:...|||.:|:::|..   :||:.:              .|
Human   137 IKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQ---FLAYSV--------------LY 184

  Fly   176 LLHRMKAGFGNTVKSLSYFR----------YVCLILNIFALGFPALMLRF--QVQILKLNSTYYQ 228
            .|:.....|...:|   |:|          :|..:|.:..:.|.:|::.|  ...::..|.|..:
Human   185 CLYIATTVFSYFIK---YWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLE 246

  Fly   229 I----------SSRHHDLGFRNNCQLIMGQRGLWTFISPSLRSPL---PHDG 267
            .          .....:|||..|.|.:.|.:..:..|      |:   |.||
Human   247 AFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLI------PIGSSPGDG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 35/136 (26%)
ZDHHC15NP_659406.1 zf-DHHC <126..308 CDD:327686 48/211 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.