DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and ZDHHC19

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001034706.1 Gene:ZDHHC19 / 131540 HGNCID:20713 Length:309 Species:Homo sapiens


Alignment Length:315 Identity:76/315 - (24%)
Similarity:113/315 - (35%) Gaps:101/315 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HPLSVI------------FLLVSTVFFFTLQVFYVAP------------DVHDG--FMYKFF-VI 61
            |||.::            |.:|..|||..|  |:..|            .|..|  |:..|| ::
Human    15 HPLPLVPRPWFLPSLFAAFNVVLLVFFSGL--FFAFPCRWLAQNGEWAFPVITGSLFVLTFFSLV 77

  Fly    62 SAIFTTYNILGNLLACYRTSSAVKSLPQERQIPKPGTEH-LW--------HYCDICQKLMPPRSW 117
            |..|:...||       ...||.:.         |.|.| :|        .:|..|....|||::
Human    78 SLNFSDPGIL-------HQGSAEQG---------PLTVHVVWVNHGAFRLQWCPKCCFHRPPRTY 126

  Fly   118 HCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKA 182
            ||..|..|:...||||.:...||||.|.|:|..|...|.......:.|..:.:.|:.:|      
Human   127 HCPWCNICVEDFDHHCKWVNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLVRTTHL------ 185

  Fly   183 GFGNTVKSLSYFRYVCLILNIFALG-FPALMLRFQVQILKLNST--YYQISSRH------HDLGF 238
                   ..|..:.:.:::.:.|.| ...|.|...:|.|.::|.  .|:...||      .|.|.
Human   186 -------PFSTDKAIAIVVAVSAAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFDQGC 243

  Fly   239 RNN--------------CQLIMGQRGL---WTF-------ISPS-LRSPLPHDGT 268
            .:|              .:.:..||.:   ||.       :||| |..|.|..|:
Human   244 ASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNLHPPMSPSALNPPAPTSGS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 33/127 (26%)
ZDHHC19NP_001034706.1 DHHC 109..>181 CDD:366691 23/71 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..309 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.