DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and zdhhc24

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_017948431.2 Gene:zdhhc24 / 100170592 XenbaseID:XB-GENE-1013799 Length:337 Species:Xenopus tropicalis


Alignment Length:267 Identity:78/267 - (29%)
Similarity:134/267 - (50%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLSVIFLLVSTVFFFTLQVFYVAPDVHDGFMYKFFVISAIFTTYNILGNLLACYRTSSAVKSLPQ 89
            |:.:..:|||:|   .|:|.|:...:........||::: :..:|::||:|...:::..:|.:..
 Frog    71 PVCITSILVSSV---ALEVVYLILTIPGNGQVMLFVLTS-YLLFNVIGNMLRFIQSNPTIKGVFL 131

  Fly    90 ERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFF----- 149
            |......|    |.||..||..:|||..||..|..|:|:|||||.....|:||:|:||||     
 Frog   132 EHGSMGQG----WEYCYSCQTHVPPRCHHCFDCNVCVLRRDHHCTLLGKCVGHSNYRYFFCTLVH 192

  Fly   150 -WLTFYLAFGIFMSMATLFVDV------GRSFYLLHR--MKAGFGNTVKSLSYFRYV---CLILN 202
             ||...||  .|:: |.:|::|      ..||:||..  |....|....|...|.:|   |:|..
 Frog   193 GWLALLLA--TFLN-AEIFMEVLHEGFGFHSFFLLLMPWMMLVTGQVTLSAFVFAFVADTCVIGF 254

  Fly   203 IFALGFPALMLRFQVQILKLNST--YYQISSRH-HDLGFRNNCQLIMGQRGLWTFISPSLRSPLP 264
            :|...|..|   ..:.:.:.::|  :::.|.:. :|||::.|....:|:|.....:||.:.|.:|
 Frog   255 LFCFAFFTL---HSILLCRGSTTKEWFRGSPKEDYDLGWKRNFMEYLGERWYLVLLSPWVESRIP 316

  Fly   265 HDGTHWK 271
            .:|.:::
 Frog   317 GNGINFQ 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 48/143 (34%)
zdhhc24XP_017948431.2 DHHC 139..279 CDD:396215 50/149 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4518
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm47643
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.