DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17196 and pigv

DIOPT Version :9

Sequence 1:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001186989.1 Gene:pigv / 100148642 ZFINID:ZDB-GENE-121116-1 Length:523 Species:Danio rerio


Alignment Length:287 Identity:62/287 - (21%)
Similarity:94/287 - (32%) Gaps:110/287 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VIFLLVSTVF-----FFTLQ-VFYVAPDVHDGFMYKFFVISAIFTTYNILGNLLACYRTSSAVKS 86
            ::.||.||:.     |.|:: ...:...:.:.|:   ||:||:           |.|..|..|. 
Zfish   109 ILRLLASTLLWPLCGFLTMRGRLIITVVIGNSFL---FVLSAV-----------ALYSLSRIVL- 158

  Fly    87 LPQERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAA-TCIGHNNHRYFFW 150
              |||::   ....:..||     |.|...:        :|......:||. |..|       .|
Zfish   159 --QERKL---AFVAVMMYC-----LTPANVF--------MLAGYSETLFATLTFAG-------LW 198

  Fly   151 -----------LTFYLAFGIFMSMATLFVDVGRSFYL-----LHRMKAGFGNTVKSLSYFRYVCL 199
                       |.|..|.|   :.|...|:||...||     |.|.:| |....:.:.|..|:..
Zfish   199 MLERRYTVGACLLFGFATG---ARANGLVNVGFLLYLTLQRCLARARA-FNKVAEGVQYHNYIWE 259

  Fly   200 ILNIFALG--FPALML----RFQVQILKLNSTYYQISSRHHDLGFRNNCQLIMGQRGLWTFISPS 258
            ::.....|  :.||:.    .||         :|         ||:..|.....|      |.|:
Zfish   260 LVRFAFTGAVYAALVALPFGLFQ---------FY---------GFQTFCHPTSNQ------IPPA 300

  Fly   259 LRSPLPHDG-------------THWKI 272
            |.:...|.|             .||:|
Zfish   301 LVNLAQHKGYRVADAASPKPKWCHWQI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 31/147 (21%)
pigvNP_001186989.1 PMT_2 23..523 CDD:304453 62/287 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.