DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and PFA3

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_014073.1 Gene:PFA3 / 855390 SGDID:S000005270 Length:336 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:60/256 - (23%)
Similarity:97/256 - (37%) Gaps:61/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNI----------FGNMLACHITSTSVESLPKD 92
            ::.|...:.:|:.|.....:..|.  ||::..|.:          |.::|. |....:...|   
Yeast    25 YITLTRIHQIPRWFLALTIVPTLA--VALYTYYKVIARGPGSPLDFPDLLV-HDLKAAENGL--- 83

  Fly    93 RQIPEPE----------EEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQ 147
             ::| ||          .:.::..|.||....|.|..||..|..||||.|.||.:.|.|.|..||
Yeast    84 -ELP-PEYMSKRCLTLKHDGRFRVCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQ 146

  Fly   148 RYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIPRDN--LPPFWLVITLILNTYVFAAP 210
            ::|..|.::..|        :....|.|..|....:.|....|  |..|.|:...:|...||.:.
Yeast   147 KFFIQFLMYTTL--------YAFLVLIYTCYELGTWFNSGSFNRELIDFHLLGVALLAVAVFISV 203

  Fly   211 VSSVLMQL-SVLKNNGTLH-----------KFYSDTY----------DLG-LWENFKLILG 248
            ::.....: .|.||..|:.           :..:|:|          ||| ...|::.|:|
Yeast   204 LAFTCFSIYQVCKNQTTIEVHGMRRYRRDLEILNDSYGTNEHLENIFDLGSSMANWQDIMG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 6/31 (19%)
zf-DHHC 100..>198 CDD:279823 31/99 (31%)
PFA3NP_014073.1 COG5273 1..304 CDD:227598 60/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.