DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and SWF1

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_010411.1 Gene:SWF1 / 851704 SGDID:S000002533 Length:336 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:67/266 - (25%)
Similarity:101/266 - (37%) Gaps:80/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLFVIVTTIFFVVL-------------QMFY---VVPQLFDVQGFMYKLGWLVAIFITYNIFGNM 76
            :|||::  |.||||             ..||   ..|.|.|.|.:.:|| .||.:|.|......:
Yeast     5 LLFVLL--IGFVVLILLSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKL-HLVPLFYTSIYLYLV 66

  Fly    77 LACHITSTSVES-------------------LP----------------KDRQIPEPEE---EHQ 103
            ...|:   .|||                   ||                ||.:....||   ::.
Yeast    67 YTYHM---RVESTIKNELFLLERILIVPIIILPPVALGILAMVSRAEDSKDHKSGSTEEYPYDYL 128

  Fly   104 WHY----CDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVA 164
            .:|    |..|..:.|.||.||.:|..|:|..|.|||:..:|:|..|...|:.|           
Yeast   129 LYYPAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLF----------- 182

  Fly   165 LATHIIATLKYFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNNGTLH- 228
            |.::|.:....|.....|.|| ....||...|.:|::...:.....:.:.| ||:::|...|.: 
Yeast   183 LISNIFSMCYAFLRLWYISLN-STSTLPRAVLTLTILCGCFTIICAIFTYL-QLAIVKEGMTTNE 245

  Fly   229 --KFYS 232
              |:|:
Yeast   246 QDKWYT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 19/57 (33%)
zf-DHHC 100..>198 CDD:279823 30/104 (29%)
SWF1NP_010411.1 COG5273 22..336 CDD:227598 59/247 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346341
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.