DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and ZDHHC12

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001304944.2 Gene:ZDHHC12 / 84885 HGNCID:19159 Length:322 Species:Homo sapiens


Alignment Length:210 Identity:53/210 - (25%)
Similarity:81/210 - (38%) Gaps:63/210 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PEPEEEHQ------------WHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQR 148
            |:|:||.:            ...|..|..|.|.|:.||..|:.|:.:.|.||.:..:|||..|..
Human   131 PQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHP 195

  Fly   149 YFFWFTLFMALGTGVALATHIIATL--KYFSYSDLIFLNIPRDNLPPF--WLVIT-LILNTYVFA 208
            .|.           |.||..::..|  .|.::|.|.|..       |:  ||..: |:..|::..
Human   196 LFV-----------VYLALQLVVLLWGLYLAWSGLRFFQ-------PWGQWLRSSGLLFATFLLL 242

  Fly   209 ---APVSSVLM--QLSVLKNNGTLHKFY------------SDTYDLGLWENFKLILGG--KGFWT 254
               :.|:|:|:  .|.::.:|.|..:|.            |:.:|.||..|......|  .|.|.
Human   243 SLFSLVASLLLVSHLYLVASNTTTWEFISSHRIAYLRQRPSNPFDRGLTRNLAHFFCGWPSGSWE 307

  Fly   255 FL---------SPTV 260
            .|         ||.|
Human   308 TLWAEEEEEGSSPAV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919
zf-DHHC 100..>198 CDD:279823 30/113 (27%)
ZDHHC12NP_001304944.2 DHHC <178..272 CDD:388695 28/111 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.